PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100212970141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 463aa    MW: 50845.6 Da    PI: 5.4262
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100212970141genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1085.1e-34285339155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+r+rWtpeLHe Fveav++LGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Ote100212970141|100212970141 285 KQRMRWTPELHETFVEAVNKLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 339
                                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.521282342IPR017930Myb domain
SuperFamilySSF466894.3E-18283339IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-31284341IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-25285339IPR006447Myb domain, plants
PfamPF002491.8E-10287338IPR001005SANT/Myb domain
PfamPF143793.0E-24370414IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MWCSCVKSSM EAKHAMPIQS SGSRQICSIG ASTSISASFP VPPTALEEMY PRFSESQQVP  60
LERELTQLPP TAVSSLSSNS GAVGHIFSSS SGFSTDLHFS STQQHQEKHP KQSPFISQSS  120
SSGKSVNLPH SVDSQVLQST ASSHFNKENN GTWCTDTLPD YLDFPMSTPT QSSQLYGSNS  180
TGITIPQEDL GKSNDWQDWA DQLITDNDAL TADWSGLLAD TSVGDPQQNL EVIFLSSSFY  240
HALLIPHQCT SISNQQLHKP QQQPITPGEI CINGTQSSSN AAPAKQRMRW TPELHETFVE  300
AVNKLGGSER ATPKGVLKLM KVEGLTIYHV KSHLQKYRTA RYKPETAEGS LEQKSASIED  360
LSSLDLKTGI EITEALRLQM EVQKRLHEQL EIQRNLQLRI EEQGRYLQMM FEKSGMEMAK  420
GATSTNSPTE DDSAVEGEKT NAEGPGENSQ PPFPPAKRAK LTD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080098.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
TrEMBLA0A022S2540.0A0A022S254_ERYGU; Uncharacterized protein
STRINGVIT_07s0005g04120.t011e-154(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349